MIF (NM_002415) Human Recombinant Protein

CAT#: TP305106

Reviews ()
Write a review

Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)



  View other "MIF" proteins (4)

USD 823.00


Availability*
In Stock

Size
    • 20 ug


Product images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC205106 protein sequence
Red=Cloning site Green=Tags(s)

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG
AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.3 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002406
Locus ID 4282
UniProt ID P14174, I4AY87
Cytogenetics 22q11.23
Refseq Size 561
Refseq ORF 345
Synonyms GIF; GLIF; MMIF
Summary This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Phenylalanine metabolism, Tyrosine metabolism

Documents

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 385.00


Rabbit anti-MIF Polyclonal Antibody
    • 100 ul

USD 275.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.