MIF (NM_002415) Human Recombinant Protein

SKU TP305106L

Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205106 protein sequence; Red=Cloning site Green=Tags(s); ; MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG; AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002406
• Locus ID: 4282
• UniProt ID: P14174
• Cytogenetics: 22q11.23
• RefSeq Size: 561
• RefSeq ORF: 345
• Synonyms: GIF; GLIF; MMIF
• Summary: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Phenylalanine metabolism, Tyrosine metabolism