MIF (NM_002415) Human Mass Spec Standard

SKU PH305106

MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205106]
• Predicted MW: 12.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC205106 protein sequence; Red=Cloning site Green=Tags(s); ; MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG; AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002406
• RefSeq Size: 561
• RefSeq ORF: 345
• Synonyms: GIF; GLIF; MMIF
• Locus ID: 4282
• UniProt ID: P14174
• Cytogenetics: 22q11.23
• Summary: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Phenylalanine metabolism, Tyrosine metabolism