OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FXYD2 (NM_001680) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305076
Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FXYD2 or NM_001680"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205076 protein sequence
Red=Cloning site Green=Tags(s)

MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 7.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001671
Locus ID 486
UniProt ID P54710
Cytogenetics 11q23.3
RefSeq Size 584
RefSeq ORF 198
Synonyms ATP1G1; HOMG2
Summary This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.provided by RefSeq, Feb 2011
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FXYD2" proteins (11)
SKU Description Size Price
PH302739 FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614) 10 ug
$3,360.00
PH305076 FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671) 10 ug
$3,360.00
PH325122 FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120961) 10 ug
$3,360.00
LC411967 Lyophilized FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419804 Lyophilized FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426799 Lyophilized FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411967 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b (as WB positive control) 100 ug
$436.00
LY419804 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a (as WB positive control) 100 ug
$436.00
LY426799 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c (as WB positive control) 100 ug
$436.00
TP302739 Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b, 20 µg 20 ug
$737.00
TP325122 Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products