FXYD2 (NM_001680) Human Mass Spec Standard

SKU PH305076

FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205076]
• Predicted MW: 7.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC205076 protein sequence; Red=Cloning site Green=Tags(s); ; MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001671
• RefSeq Size: 584
• RefSeq ORF: 198
• Synonyms: ATP1G1; HOMG2
• Locus ID: 486
• UniProt ID: P54710
• Cytogenetics: 11q23.3
• Summary: This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane