OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FXYD2 (NM_021603) Human Mass Spec Standard

Be the first to review this product
SKU
PH302739
FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411967 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b (as WB positive control) 100 ug
$436.00

Other products for "FXYD2 or NM_021603"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202739
Predicted MW 7.4 kDa
Protein Sequence
Protein Sequence
>RC202739 protein sequence
Red=Cloning site Green=Tags(s)

MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067614
RefSeq Size 591
RefSeq ORF 192
Synonyms ATP1G1; HOMG2
Locus ID 486
UniProt ID P54710
Cytogenetics 11q23.3
Summary This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.provided by RefSeq, Feb 2011
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FXYD2" proteins (11)
SKU Description Size Price
PH305076 FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671) 10 ug
$3,360.00
PH325122 FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120961) 10 ug
$3,360.00
LC411967 Lyophilized FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419804 Lyophilized FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426799 Lyophilized FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411967 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b (as WB positive control) 100 ug
$436.00
LY419804 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a (as WB positive control) 100 ug
$436.00
LY426799 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c (as WB positive control) 100 ug
$436.00
TP302739 Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b, 20 µg 20 ug
$737.00
TP305076 Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, 20 µg 20 ug
$737.00
TP325122 Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products