FXYD2 (NM_021603) Human Mass Spec Standard

SKU
PH302739
FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202739]
Predicted MW 7.4 kDa
Protein Sequence
Protein Sequence
>RC202739 protein sequence
Red=Cloning site Green=Tags(s)

MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067614
RefSeq Size 591
RefSeq ORF 192
Synonyms ATP1G1; HOMG2
Locus ID 486
UniProt ID P54710
Cytogenetics 11q23.3
Summary This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Write Your Own Review
You're reviewing:FXYD2 (NM_021603) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305076 FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671) 10 ug
$3,255.00
PH325122 FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120961) 10 ug
$3,255.00
LC411967 FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419804 FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426799 FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411967 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b 100 ug
$436.00
LY419804 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a 100 ug
$436.00
LY426799 Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c 100 ug
$436.00
TP302739 Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b, 20 µg 20 ug
$737.00
TP305076 Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, 20 µg 20 ug
$737.00
TP325122 Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.