OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PUF60 (NM_014281) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303454
Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA343804 Rabbit Polyclonal Anti-PUF60 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PUF60 or NM_014281"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203454 protein sequence
Red=Cloning site Green=Tags(s)

MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA
KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKS
IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNR
IYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYL
RVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTL
PQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ
EHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEE
DAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055096
Locus ID 22827
UniProt ID Q9UHX1
Cytogenetics 8q24.3
RefSeq Size 1897
RefSeq ORF 1626
Synonyms FIR; RoBPI; SIAHBP1; VRJS
Summary This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Aug 2012
Protein Categories Intracellular Proteins
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PUF60" proteins (7)
SKU Description Size Price
PH303454 PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_055096) 10 ug
$3,360.00
PH323492 PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_510965) 10 ug
$3,360.00
LC409189 Lyophilized PUF60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415385 Lyophilized PUF60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409189 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY415385 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP323492 Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

The prevalence and clinical significance of anti-PUF60 antibodies in patients with idiopathic inflammatory myopathy
Zhang, Yang, Shi et al
Clin. Rheumatol. (2018)
AI Summary: OriGene’s recombinant full-length human PUF60 protein was used to coat ELISA plates for detecting anti-PUF60 antibodies in patient sera, enabling the assessment of their prevalence and clinical significance in idiopathic inflammatory myopathy.
Snippet: Briefly, 96-well MaxiSorb ELISA plates (Thermo Fisher Scientific, USA) were coated with 50 ng/well of recombinant full-length human PUF60 (Origene, Rockville, USA), diluted in carbonate buffer (pH 9.6), and incubated overnight at 4 °C. Human sera were measured
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products