PUF60 (NM_078480) Human Recombinant Protein

SKU
TP323492
Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC223492
Blue=ORF Red=Cloning site Green=Tag(s)

MATATIALVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA
KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYE
LGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNI
GQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKA
QSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLG
TLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEP
KKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVT
EECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFD
NSDLSA

myc-FLAG tag

Recombinant protein using RC223492 also available, TP323492
Tag C-Myc/DDK
Predicted MW 59.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity WB positive control (PMID: 26253095)
ELISA capture for autoantibodies (PMID: 29541951)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_510965
Locus ID 22827
UniProt ID Q9UHX1
Cytogenetics 8q24.3
RefSeq Size 1946
RefSeq ORF 1674
Synonyms FIR; RoBPI; SIAHBP1; VRJS
Summary This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:PUF60 (NM_078480) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303454 PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_055096) 10 ug
$3,255.00
PH323492 PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_510965) 10 ug
$3,255.00
LC409189 PUF60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415385 PUF60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409189 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1 100 ug
$665.00
LY415385 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 2 100 ug
$436.00
TP303454 Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.