OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PUF60 (NM_078480) Human Mass Spec Standard

Be the first to review this product
SKU
PH323492
PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_510965)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343804 Rabbit Polyclonal Anti-PUF60 Antibody
100 ul
$585.00
LY409189 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "PUF60 or NM_078480"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223492
Predicted MW 59.7 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC223492
Blue=ORF Red=Cloning site Green=Tag(s)

MATATIALVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA
KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYE
LGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNI
GQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKA
QSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLG
TLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEP
KKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVT
EECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFD
NSDLSA
myc-FLAG tag

Recombinant protein using RC223492 also available, TP323492
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_510965
RefSeq Size 1946
RefSeq ORF 1674
Synonyms FIR; RoBPI; SIAHBP1; VRJS
Locus ID 22827
UniProt ID Q9UHX1
Cytogenetics 8q24.3
Summary This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Aug 2012
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PUF60" proteins (7)
SKU Description Size Price
PH303454 PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_055096) 10 ug
$3,360.00
LC409189 Lyophilized PUF60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415385 Lyophilized PUF60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409189 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY415385 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303454 Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 20 µg 20 ug
$867.00
TP323492 Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products