PUF60 (NM_014281) Human Mass Spec Standard

SKU
PH303454
PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_055096)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203454]
Predicted MW 58.2 kDa
Protein Sequence
Protein Sequence
>RC203454 protein sequence
Red=Cloning site Green=Tags(s)

MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA
KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKS
IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNR
IYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYL
RVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTL
PQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ
EHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEE
DAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055096
RefSeq Size 1897
RefSeq ORF 1626
Synonyms FIR; RoBPI; SIAHBP1; VRJS
Locus ID 22827
UniProt ID Q9UHX1
Cytogenetics 8q24.3
Summary This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:PUF60 (NM_014281) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323492 PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_510965) 10 ug
$3,255.00
LC409189 PUF60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415385 PUF60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409189 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1 100 ug
$665.00
LY415385 Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 2 100 ug
$436.00
TP303454 Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 20 µg 20 ug
$867.00
TP323492 Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.