OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLK1 (NM_005030) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301795
Recombinant protein of human polo-like kinase 1 (Drosophila) (PLK1), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500389 PLK1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PLK1 or NM_005030"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201795 representing NM_005030
Red=Cloning site Green=Tags(s)

MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEI
SDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLE
LHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKT
LCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAAS
LIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENP
LPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHL
LKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFR
TYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 68.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity In vitro kinase assay substrate (ELISA) (PMID: 28024153)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005021
Locus ID 5347
UniProt ID P53350
Cytogenetics 16p12.2
RefSeq Size 2204
RefSeq ORF 1809
Synonyms PLK; STPK13
Summary The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cell proliferation and induced apoptosis; hence, it is a target for cancer therapy. provided by RefSeq, Sep 2015
Protein Categories Cytokines, Enzyme: Kinases, Intracellular Proteins
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLK1" proteins (3)
SKU Description Size Price
PH301795 PLK1 MS Standard C13 and N15-labeled recombinant protein (NP_005021) 10 ug
$3,360.00
LC417592 Lyophilized PLK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417592 Transient overexpression lysate of polo-like kinase 1 (Drosophila) (PLK1) (as WB positive control) 100 ug
$436.00

file-alt Citations

Synergistic apoptotic effect of miR-183-5p and Polo-Like kinase 1 inhibitor NMS-P937 in breast cancer cells
Kudo, Zalles, Distefano et al
Cell Death Differ (2021)
Cited by 10
AI Summary: OriGene’s PLK1 CDS expression vector was used to generate constructs with and without the PLK1 3′UTR, enabling the authors to confirm that miR-183-5p specifically reduces PLK1 protein levels via 3′UTR binding in breast cancer cells.
Snippet: To confirm that miR-183-5p binding was specifically responsible for the reduction of PLK1 protein, PLK1 3′UTR was inserted downstream of the PLK1 CDS expression vector (Origene, Rockville, MD, USA), generating PLK1 CDS-only and PLK1 CDS + 3′UTR
HIV-1 blocks the signaling adaptor MAVS to evade antiviral host defense after sensing of abortive HIV-1 RNA by the host helicase DDX3
Gringhuis, Hertoghs, Kaptein et al
Nat. Immunol. (2016)
AI Summary: OriGene’s Thr210-phosphorylated Flag–PLK1 protein was used in capture ELISA assays to investigate the interaction between PLK1 and MAVS, helping to elucidate how HIV-1 disrupts antiviral signaling in dendritic cells.
Snippet: Association of PLK1 with either wild-type or mutant MAVS was further examined by capture ELISA. 50 ng Thr210-phosphorylated Flag–PLK1 (Origene;see below) was immobilized on anti-PLK1 (4513;Cell Signaling)-coated high-binding 96-well plates and incubated with whole-cell extracts (see above) from immature DCs from donors with either the minor or major genotype for rs7262903 and rs7269320
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products