OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DOHH (NM_031304) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301340
Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA384118 DOHH Rabbit monoclonal Antibody
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DOHH or NM_031304"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201340 representing NM_031304
Red=Cloning site Green=Tags(s)

MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA
IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA
AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG
YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY
EHETGRAFQYADGLEQLRGAPS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_112594
Locus ID 83475
UniProt ID Q9BU89
Cytogenetics 19p13.3
RefSeq Size 1772
RefSeq ORF 906
Synonyms hDOHH; HLRC1
Summary This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants.provided by RefSeq, Feb 2009
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DOHH" proteins (7)
SKU Description Size Price
PH301340 DOHH MS Standard C13 and N15-labeled recombinant protein (NP_112594) 10 ug
$3,360.00
PH326938 DOHH MS Standard C13 and N15-labeled recombinant protein (NP_001138637) 10 ug
$3,360.00
LC410554 Lyophilized DOHH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428737 Lyophilized DOHH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410554 Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428737 Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP326938 Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products