DOHH (NM_001145165) Human Mass Spec Standard

SKU
PH326938
DOHH MS Standard C13 and N15-labeled recombinant protein (NP_001138637)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226938]
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC226938 representing NM_001145165
Red=Cloning site Green=Tags(s)

MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA
IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA
AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG
YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY
EHETGRAFQYADGLEQLRGAPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138637
RefSeq ORF 906
Synonyms hDOHH; HLRC1
Locus ID 83475
UniProt ID Q9BU89
Cytogenetics 19p13.3
Summary This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:DOHH (NM_001145165) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301340 DOHH MS Standard C13 and N15-labeled recombinant protein (NP_112594) 10 ug
$3,255.00
LC410554 DOHH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428737 DOHH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410554 Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2 100 ug
$436.00
LY428737 Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1 100 ug
$436.00
TP301340 Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326938 Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.