DOHH (NM_001145165) Human Recombinant Protein
SKU
TP326938
Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC226938 representing NM_001145165
Red=Cloning site Green=Tags(s) MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY EHETGRAFQYADGLEQLRGAPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001138637 |
Locus ID | 83475 |
UniProt ID | Q9BU89 |
Cytogenetics | 19p13.3 |
RefSeq ORF | 906 |
Synonyms | hDOHH; HLRC1 |
Summary | This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301340 | DOHH MS Standard C13 and N15-labeled recombinant protein (NP_112594) | 10 ug |
$3,255.00
|
|
PH326938 | DOHH MS Standard C13 and N15-labeled recombinant protein (NP_001138637) | 10 ug |
$3,255.00
|
|
LC410554 | DOHH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428737 | DOHH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410554 | Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2 | 100 ug |
$436.00
|
|
LY428737 | Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1 | 100 ug |
$436.00
|
|
TP301340 | Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.