OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EXOSC3 (NM_016042) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300035
Recombinant protein of human exosome component 3 (EXOSC3), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA504794 EXOSC3 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EXOSC3 or NM_016042"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200035 protein sequence
Red=Cloning site Green=Tags(s)

MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG
LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS
LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL
LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057126
Locus ID 51010
UniProt ID Q9NQT5
Cytogenetics 9p13.2
RefSeq Size 1857
RefSeq ORF 825
Synonyms bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
Summary This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Jun 2012
Protein Categories Intracellular Proteins
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EXOSC3" proteins (7)
SKU Description Size Price
PH300035 EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_057126) 10 ug
$3,360.00
PH318361 EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_001002269) 10 ug
$3,360.00
LC414229 Lyophilized EXOSC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424199 Lyophilized EXOSC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414229 Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424199 Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP318361 Purified recombinant protein of Homo sapiens exosome component 3 (EXOSC3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products