EXOSC3 (NM_001002269) Human Mass Spec Standard

SKU PH318361

EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_001002269)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC218361]
• Predicted MW: 17.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC218361 representing NM_001002269; Red=Cloning site Green=Tags(s); ; MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG; LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS; LSYLSFEGATKRNRPNVQAISSRL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001002269
• RefSeq Size: 1070
• RefSeq ORF: 492
• Synonyms: bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
• Locus ID: 51010
• UniProt ID: Q9NQT5
• Cytogenetics: 9p13.2
• Summary: This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation