EXOSC3 (NM_016042) Human Mass Spec Standard

SKU
PH300035
EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_057126)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200035]
Predicted MW 29.6 kDa
Protein Sequence
Protein Sequence
>RC200035 protein sequence
Red=Cloning site Green=Tags(s)

MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG
LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS
LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL
LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057126
RefSeq Size 1857
RefSeq ORF 825
Synonyms bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
Locus ID 51010
UniProt ID Q9NQT5
Cytogenetics 9p13.2
Summary This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Write Your Own Review
You're reviewing:EXOSC3 (NM_016042) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318361 EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_001002269) 10 ug
$3,255.00
LC414229 EXOSC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424199 EXOSC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414229 Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 1 100 ug
$436.00
LY424199 Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 2 100 ug
$436.00
TP300035 Recombinant protein of human exosome component 3 (EXOSC3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318361 Purified recombinant protein of Homo sapiens exosome component 3 (EXOSC3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.