EXOSC3 (NM_016042) Human Tagged ORF Clone

SKU
RC200035
EXOSC3 (Myc-DDK-tagged)-Human exosome component 3 (EXOSC3), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EXOSC3
Synonyms bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200035 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAACCTGCGTCTGTCGCGGCTGAATCTCTCGCGGGCAGCAGGGCGCGCGCTGCACGCACAGTAC
TAGGTCAGGTGGTGCTCCCGGGTGAGGAGCTGCTCCTGCCGGAACAGGAGGACGCGGAAGGCCCTGGGGG
TGCAGTGGAGCGACCGTTGAGCCTGAATGCTAGAGCGTGCTCGCGGGTGCGCGTTGTATGCGGTCCGGGC
CTTCGGCGCTGTGGGGACCGCCTGCTGGTCACCAAGTGCGGCCGCCTCCGTCACAAGGAGCCCGGCAGTG
GCAGCGGCGGCGGTGTTTACTGGGTGGACTCTCAGCAGAAGCGGTATGTTCCAGTAAAAGGAGACCATGT
GATTGGCATAGTGACAGCTAAATCTGGAGATATATTCAAAGTTGATGTTGGAGGGAGTGAGCCAGCTTCT
TTGTCTTACTTGTCATTTGAAGGTGCAACTAAAAGAAACAGACCAAATGTGCAGGTTGGAGATCTCATCT
ATGGCCAATTTGTGGTTGCTAATAAAGACATGGAACCAGAGATGGTCTGTATTGACAGCTGTGGACGAGC
CAATGGAATGGGTGTCATTGGACAGGATGGTCTGCTTTTTAAAGTGACTCTGGGCTTAATTAGAAAGCTA
TTAGCTCCAGATTGTGAAATCATACAGGAAGTGGGAAAACTCTATCCACTGGAGATAGTATTTGGAATGA
ATGGAAGAATATGGGTTAAGGCAAAAACCATCCAGCAGACTTTAATTTTGGCAAACATTTTAGAAGCTTG
TGAACACATGACGTCAGATCAAAGAAAACAGATCTTCTCCAGATTGGCAGAAAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200035 protein sequence
Red=Cloning site Green=Tags(s)

MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG
LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS
LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL
LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016042
ORF Size 825 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016042.4
RefSeq Size 1857 bp
RefSeq ORF 828 bp
Locus ID 51010
UniProt ID Q9NQT5
Cytogenetics 9p13.2
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
MW 29.6 kDa
Summary This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]
Write Your Own Review
You're reviewing:EXOSC3 (NM_016042) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200035L3 Lenti ORF clone of Human exosome component 3 (EXOSC3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200035L4 Lenti ORF clone of Human exosome component 3 (EXOSC3), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200035 EXOSC3 (tGFP-tagged) - Human exosome component 3 (EXOSC3), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC321585 EXOSC3 (untagged)-Human exosome component 3 (EXOSC3), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.