OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GALE (NM_001127621) Human Mass Spec Standard

Be the first to review this product
SKU
PH325521
GALE MS Standard C13 and N15-labeled recombinant protein (NP_001121093)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502146 GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4) 100 ul
$447.00
LY424739 Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GALE or NM_001127621"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225521
Predicted MW 38.3 kDa
Protein Sequence
Protein Sequence
>RC225521 protein sequence
Red=Cloning site Green=Tags(s)

MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQ
GALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQ
YLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMP
YVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQM
VQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001121093
RefSeq Size 1626
RefSeq ORF 1044
Synonyms SDR1E1
Locus ID 2582
UniProt ID Q14376
Cytogenetics 1p36.11
Summary This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and cognitive disability, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). Multiple alternatively spliced transcripts encoding the same protein have been identified. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GALE" proteins (12)
SKU Description Size Price
PH301561 GALE MS Standard C13 and N15-labeled recombinant protein (NP_000394) 10 ug
$3,360.00
PH308709 GALE MS Standard C13 and N15-labeled recombinant protein (NP_001008217) 10 ug
$3,360.00
LC423394 Lyophilized GALE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424739 Lyophilized GALE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426826 Lyophilized GALE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423394 Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424739 Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426826 Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301561 Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 1, 20 µg 20 ug
$867.00
TP308709 Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 2, 20 µg 20 ug
$867.00
TP325521 Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 3, 20 µg 20 ug
$867.00
TP720236 Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products