GALE (NM_000403) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201561] |
Predicted MW | 38.3 kDa |
Protein Sequence |
Protein Sequence
>RC201561 protein sequence
Red=Cloning site Green=Tags(s) MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQ GALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQ YLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMP YVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQM VQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_000394 |
RefSeq Size | 1647 |
RefSeq ORF | 1044 |
Synonyms | SDR1E1 |
Locus ID | 2582 |
UniProt ID | Q14376 |
Cytogenetics | 1p36.11 |
Summary | This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and cognitive disability, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). Multiple alternatively spliced transcripts encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308709 | GALE MS Standard C13 and N15-labeled recombinant protein (NP_001008217) | 10 ug |
$3,255.00
|
|
PH325521 | GALE MS Standard C13 and N15-labeled recombinant protein (NP_001121093) | 10 ug |
$3,255.00
|
|
LC423394 | GALE HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424739 | GALE HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426826 | GALE HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY423394 | Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 2 | 100 ug |
$436.00
|
|
LY424739 | Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 1 | 100 ug |
$436.00
|
|
LY426826 | Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 3 | 100 ug |
$436.00
|
|
TP301561 | Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP308709 | Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP325521 | Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720236 | Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 1 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.