GALE (NM_000403) Human Tagged ORF Clone

SKU
RC201561
GALE (Myc-DDK-tagged)-Human UDP-galactose-4-epimerase (GALE), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GALE
Synonyms SDR1E1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201561 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGAAGGTGCTGGTAACAGGTGGGGCTGGCTACATTGGCAGCCACACGGTGCTGGAGCTGCTGG
AGGCTGGCTACTTGCCTGTGGTCATCGATAACTTCCATAATGCCTTCCGTGGAGGGGGCTCCCTGCCTGA
GAGCCTGCGGCGGGTCCAGGAGCTGACAGGCCGCTCTGTGGAGTTTGAGGAGATGGACATTTTGGACCAG
GGAGCCCTACAGCGTCTCTTCAAAAAGTACAGCTTTATGGCGGTCATCCACTTTGCGGGGCTCAAGGCCG
TGGGCGAGTCGGTGCAGAAGCCTCTGGATTATTACAGAGTTAACCTGACCGGGACCATCCAGCTTCTGGA
GATCATGAAGGCCCACGGGGTGAAGAACCTGGTGTTCAGCAGCTCAGCCACTGTGTACGGGAACCCCCAG
TACCTGCCCCTTGATGAGGCCCACCCCACGGGTGGTTGTACCAACCCTTACGGCAAGTCCAAGTTCTTCA
TCGAGGAAATGATCCGGGACCTGTGCCAGGCAGACAAGACTTGGAACGCAGTGCTGCTGCGCTATTTCAA
CCCCACAGGTGCCCATGCCTCTGGCTGCATTGGTGAGGATCCCCAGGGCATACCCAACAACCTCATGCCT
TATGTCTCCCAGGTGGCGATCGGGCGACGGGAGGCCCTGAATGTCTTTGGCAATGACTATGACACAGAGG
ATGGCACAGGTGTCCGGGATTACATCCATGTCGTGGATCTGGCCAAGGGCCACATTGCAGCCTTAAGGAA
GCTGAAAGAACAGTGTGGCTGCCGGATCTACAACCTGGGCACGGGCACAGGCTATTCAGTGCTGCAGATG
GTCCAGGCTATGGAGAAGGCCTCTGGGAAGAAGATCCCGTACAAGGTGGTGGCACGGCGGGAAGGTGATG
TGGCAGCCTGTTACGCCAACCCCAGCCTGGCCCAAGAGGAGCTGGGGTGGACAGCAGCCTTAGGGCTGGA
CAGGATGTGTGAGGATCTCTGGCGCTGGCAGAAGCAGAATCCTTCAGGCTTTGGCACGCAAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201561 protein sequence
Red=Cloning site Green=Tags(s)

MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQ
GALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQ
YLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMP
YVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQM
VQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000403
ORF Size 1044 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000403.4
RefSeq Size 1647 bp
RefSeq ORF 1047 bp
Locus ID 2582
UniProt ID Q14376
Cytogenetics 1p36.11
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways
MW 38.3 kDa
Summary This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and cognitive disability, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). Multiple alternatively spliced transcripts encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GALE (NM_000403) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201561L1 Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201561L2 Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 1, mGFP tagged 10 ug
$757.00
RC201561L3 Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201561L4 Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 1, mGFP tagged 10 ug
$757.00
RG201561 GALE (tGFP-tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC119907 GALE (untagged)-Human UDP-galactose-4-epimerase (GALE), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.