Germany
Japan
United Kingdom
China
GMPR2 (NM_001002002) Human Mass Spec Standard
CAT#: PH323106
GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223106 |
| Predicted MW | 37.9 kDa |
| Protein Sequence |
>RC223106 protein sequence
Red=Cloning site Green=Tags(s) MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKF SLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVE FVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAH GLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG GVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
| Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001002002 |
| RefSeq Size | 1669 |
| RefSeq ORF | 1044 |
| Synonyms | GMPR 2 |
| Locus ID | 51292 |
| UniProt ID | Q9P2T1 |
| Cytogenetics | 14q12 |
| Summary | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413898 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LC424314 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LC424315 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LC424316 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LY413898 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 |
USD 436.00 |
|
| LY424314 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 |
USD 436.00 |
|
| LY424315 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 |
USD 436.00 |
|
| LY424316 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 |
USD 436.00 |
|
| PH303418 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) |
USD 3,255.00 |
|
| PH303584 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660) |
USD 3,255.00 |
|
| PH310599 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) |
USD 3,255.00 |
|
| TP303418 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg |
USD 867.00 |
|
| TP303584 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 20 µg |
USD 867.00 |
|
| TP310599 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 20 µg |
USD 867.00 |
|
| TP323106 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review