OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MEIS2 (NM_170677) Human Mass Spec Standard

Be the first to review this product
SKU
PH322807
MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733777)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337288 Rabbit Polyclonal Anti-MEIS2 Antibody
100 ul
$585.00
LY406905 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant a (as WB positive control) 100 ug
$436.00

Other products for "MEIS2 or NM_170677"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222807
Predicted MW 43.6 kDa
Protein Sequence
Protein Sequence
>RC222807 representing NM_170677
Red=Cloning site Green=Tags(s)

MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVN
DALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSN
PELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNL
ADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKR
GIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLD
PSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_733777
RefSeq Size 3721
RefSeq ORF 1203
Synonyms CPCMR; HsT18361; MRG1
Locus ID 4212
UniProt ID O14770
Cytogenetics 15q14
Summary This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MEIS2" proteins (15)
SKU Description Size Price
PH301395 MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_002390) 10 ug
$3,360.00
PH308386 MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733776) 10 ug
$3,360.00
LC406902 Lyophilized MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406903 Lyophilized MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406904 Lyophilized MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406905 Lyophilized MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419351 Lyophilized MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406902 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant b (as WB positive control) 100 ug
$436.00
LY406903 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant c (as WB positive control) 100 ug
$665.00
LY406904 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant d (as WB positive control) 100 ug
$436.00
LY406905 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant a (as WB positive control) 100 ug
$436.00
LY419351 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant f (as WB positive control) 100 ug
$436.00
TP301395 Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant f, 20 µg 20 ug
$867.00
TP308386 Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant d, 20 µg 20 ug
$867.00
TP322807 Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant a, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products