MEIS2 (NM_170676) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC208386] |
Predicted MW | 51.1 kDa |
Protein Sequence |
Protein Sequence
>RC208386 protein sequence
Red=Cloning site Green=Tags(s) MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVN DALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSN PELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNL ADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKR GIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGA AYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHS YLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_733776 |
RefSeq Size | 3256 |
RefSeq ORF | 1410 |
Synonyms | CPCMR; HsT18361; MRG1 |
Locus ID | 4212 |
UniProt ID | O14770 |
Cytogenetics | 15q14 |
Summary | This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301395 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_002390) | 10 ug |
$3,255.00
|
|
PH322807 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733777) | 10 ug |
$3,255.00
|
|
LC406902 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406903 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC406904 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406905 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419351 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406902 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant b | 100 ug |
$436.00
|
|
LY406903 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant c | 100 ug |
$665.00
|
|
LY406904 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant d | 100 ug |
$436.00
|
|
LY406905 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant a | 100 ug |
$436.00
|
|
LY419351 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant f | 100 ug |
$436.00
|
|
TP301395 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant f, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP308386 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant d, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP322807 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant a, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.