MEIS2 (NM_002399) Human Mass Spec Standard

SKU
PH301395
MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_002390)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201395]
Predicted MW 41.5 kDa
Protein Sequence
Protein Sequence
>RC201395 protein sequence
Red=Cloning site Green=Tags(s)

MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGH
PLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQV
LRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDD
ATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRA
WLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFV
LDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002390
RefSeq Size 3074
RefSeq ORF 1143
Synonyms CPCMR; HsT18361; MRG1
Locus ID 4212
UniProt ID O14770
Cytogenetics 15q14
Summary This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:MEIS2 (NM_002399) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308386 MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733776) 10 ug
$3,255.00
PH322807 MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733777) 10 ug
$3,255.00
LC406902 MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406903 MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406904 MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406905 MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419351 MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406902 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant b 100 ug
$436.00
LY406903 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant c 100 ug
$665.00
LY406904 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant d 100 ug
$436.00
LY406905 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant a 100 ug
$436.00
LY419351 Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant f 100 ug
$436.00
TP301395 Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant f, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP308386 Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant d, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322807 Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.