MEIS2 (NM_002399) Human Recombinant Protein
SKU
TP301395
Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant f, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201395 protein sequence
Red=Cloning site Green=Tags(s) MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGH PLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQV LRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDD ATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRA WLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFV LDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002390 |
Locus ID | 4212 |
UniProt ID | O14770 |
Cytogenetics | 15q14 |
RefSeq Size | 3074 |
RefSeq ORF | 1143 |
Synonyms | CPCMR; HsT18361; MRG1 |
Summary | This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301395 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_002390) | 10 ug |
$3,255.00
|
|
PH308386 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733776) | 10 ug |
$3,255.00
|
|
PH322807 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733777) | 10 ug |
$3,255.00
|
|
LC406902 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406903 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC406904 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406905 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419351 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406902 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant b | 100 ug |
$436.00
|
|
LY406903 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant c | 100 ug |
$665.00
|
|
LY406904 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant d | 100 ug |
$436.00
|
|
LY406905 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant a | 100 ug |
$436.00
|
|
LY419351 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant f | 100 ug |
$436.00
|
|
TP308386 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant d, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP322807 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant a, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.