OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HTRA1 (NM_002775) Human Mass Spec Standard

Be the first to review this product
SKU
PH322362
HTRA1 MS Standard C13 and N15-labeled recombinant protein (NP_002766)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324517 HtrA1 Antibody (N-term)
200 ul
$645.00
LY400983 Transient overexpression lysate of HtrA serine peptidase 1 (HTRA1) (as WB positive control) 100 ug
$665.00

Other products for "HTRA1 or NM_002775"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222362
Predicted MW 51.3 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC222362
Blue=ORF Red=Cloning site Green=Tag(s)

MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCG
APEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRR
SERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGF
IVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPG
EFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTL
KVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYI
IEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP


Recombinant protein using RC222362 also available, TP322362
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002766
RefSeq Size 2133
RefSeq ORF 1440
Synonyms ARMD7; CADASIL2; CARASIL; HtrA; L56; ORF480; PRSS11
Locus ID 5654
UniProt ID Q92743
Cytogenetics 10q26.13
Summary This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protease, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HTRA1" proteins (4)
SKU Description Size Price
LC400983 Lyophilized HTRA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400983 Transient overexpression lysate of HtrA serine peptidase 1 (HTRA1) (as WB positive control) 100 ug
$665.00
TP322362 Recombinant protein of human HtrA serine peptidase 1 (HTRA1), 20 µg 20 ug
$867.00
TP700208 Recombinant protein of human HtrA serine peptidase 1 (HTRA1), S328A mutant, 20 ug 20 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products