DHRS9 (NM_199204) Human Mass Spec Standard

CAT#: PH320853

DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_954674)

Product Images

Coomassie blue staining of purified DHRS9 protein (Cat# TP320853). The protein was produced from HEK293T cells transfected with DHRS9 cDNA clone (Cat# RC220853) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220853
• Predicted MW: 35.2 kDa
• Protein Sequence:
  Sequence Link

  >RC220853 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK
  AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG
  LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK
  TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH
  YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_954674
• RefSeq Size: 1993
• RefSeq ORF: 957
• Synonyms: 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4
• Locus ID: 10170
• UniProt ID: Q9BPW9
• Cytogenetics: 2q31.1
• Summary: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Retinol metabolism