OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DHRS9 (NM_001142271) Human Mass Spec Standard

Be the first to review this product
SKU
PH326904
DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135743)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375457 DHRS9 Rabbit polyclonal Antibody
100 ul
$410.00
LY404693 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DHRS9 or NM_001142271"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226904
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC226904 protein sequence
Red=Cloning site Green=Tags(s)

MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK
AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG
LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK
TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH
YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001135743
RefSeq Size 1483
RefSeq ORF 957
Synonyms 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4
Locus ID 10170
UniProt ID Q9BPW9
Cytogenetics 2q31.1
Summary This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2014
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Retinol metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DHRS9" proteins (15)
SKU Description Size Price
PH320853 DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_954674) 10 ug
$3,360.00
PH326895 DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135742) 10 ug
$3,360.00
LC404693 Lyophilized DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417061 Lyophilized DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427994 Lyophilized DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427995 Lyophilized DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429267 Lyophilized DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404693 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY417061 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427994 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427995 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY429267 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP320853 Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 20 µg 20 ug
$867.00
TP326895 Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3, 20 µg 20 ug
$867.00
TP326904 Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products