DHRS9 (NM_001142271) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC226904] |
Predicted MW | 35.2 kDa |
Protein Sequence |
Protein Sequence
>RC226904 protein sequence
Red=Cloning site Green=Tags(s) MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001135743 |
RefSeq Size | 1483 |
RefSeq ORF | 957 |
Synonyms | 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4 |
Locus ID | 10170 |
UniProt ID | Q9BPW9 |
Cytogenetics | 2q31.1 |
Summary | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH320853 | DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_954674) | 10 ug |
$3,255.00
|
|
PH326895 | DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135742) | 10 ug |
$3,255.00
|
|
LC404693 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417061 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427994 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427995 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429267 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404693 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2 | 100 ug |
$436.00
|
|
LY417061 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 | 100 ug |
$436.00
|
|
LY427994 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3 | 100 ug |
$436.00
|
|
LY427995 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4 | 100 ug |
$436.00
|
|
LY429267 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 | 100 ug |
$436.00
|
|
TP320853 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP326895 | Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP326904 | Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.