DHRS9 (NM_199204) Human Mass Spec Standard

SKU
PH320853
DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_954674)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220853]
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC220853 protein sequence
Red=Cloning site Green=Tags(s)

MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK
AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG
LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK
TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH
YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_954674
RefSeq Size 1993
RefSeq ORF 957
Synonyms 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4
Locus ID 10170
UniProt ID Q9BPW9
Cytogenetics 2q31.1
Summary This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Retinol metabolism
Write Your Own Review
You're reviewing:DHRS9 (NM_199204) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326895 DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135742) 10 ug
$3,255.00
PH326904 DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135743) 10 ug
$3,255.00
LC404693 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417061 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427994 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427995 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429267 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404693 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2 100 ug
$436.00
LY417061 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 100 ug
$436.00
LY427994 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3 100 ug
$436.00
LY427995 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4 100 ug
$436.00
LY429267 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 100 ug
$436.00
TP320853 Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326895 Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326904 Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.