DHRS9 (NM_001142271) Human Recombinant Protein

SKU
TP326904
Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226904 protein sequence
Red=Cloning site Green=Tags(s)

MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK
AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG
LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK
TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH
YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001135743
Locus ID 10170
UniProt ID Q9BPW9
Cytogenetics 2q31.1
RefSeq Size 1483
RefSeq ORF 957
Synonyms 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4
Summary This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Retinol metabolism
Write Your Own Review
You're reviewing:DHRS9 (NM_001142271) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH320853 DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_954674) 10 ug
$3,255.00
PH326895 DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135742) 10 ug
$3,255.00
PH326904 DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135743) 10 ug
$3,255.00
LC404693 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417061 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427994 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427995 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429267 DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404693 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2 100 ug
$436.00
LY417061 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 100 ug
$436.00
LY427994 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3 100 ug
$436.00
LY427995 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4 100 ug
$436.00
LY429267 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 100 ug
$436.00
TP320853 Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326895 Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.