OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BCAT1 (NM_005504) Human Mass Spec Standard

Be the first to review this product
SKU
PH319229
BCAT1 MS Standard C13 and N15-labeled recombinant protein (NP_005495)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504360 BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5) 100 ul
$447.00
LY432891 Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "BCAT1 or NM_005504"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219229
Predicted MW 42.8 kDa
Protein Sequence
Protein Sequence
>RC219229 representing NM_005504
Red=Cloning site Green=Tags(s)

MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEK
PHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLEC
IQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKY
VRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPP
LDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETI
HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005495
RefSeq Size 8191
RefSeq ORF 1158
Synonyms BCATC; BCT1; ECA39; MECA39; PNAS121; PP18
Locus ID 586
UniProt ID P54687
Cytogenetics 12p12.1
Summary This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders. Alternatively spliced transcript variants have been described. provided by RefSeq, May 2010
Protein Families Druggable Genome
Protein Pathways leucine and isoleucine biosynthesis, leucine and isoleucine degradation, Metabolic pathways, Pantothenate and CoA biosynthesis, Valine
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BCAT1" proteins (12)
SKU Description Size Price
LC401683 Lyophilized BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432891 Lyophilized BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432924 Lyophilized BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432972 Lyophilized BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432999 Lyophilized BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401683 Transient overexpression lysate of branched chain aminotransferase 1, cytosolic (BCAT1) (as WB positive control) 100 ug
$436.00
LY432891 Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY432924 Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432972 Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY432999 Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP319229 Recombinant protein of human branched chain aminotransferase 1, cytosolic (BCAT1), 20 µg 20 ug
$867.00
TP760653 Purified recombinant protein of Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products