OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BCAT1 (NM_005504) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC219229
BCAT1 (Myc-DDK-tagged)-Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA504360 BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "BCAT1 or NM_005504"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BCAT1
Synonyms BCATC; BCT1; ECA39; MECA39; PNAS121; PP18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219229 representing NM_005504
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGATTGCAGTAACGGATGCTCCGCAGAGTGTACCGGAGAAGGAGGATCAAAAGAGGTGGTGGGGA
CTTTTAAGGCTAAAGACCTAATAGTCACACCAGCTACCATTTTAAAGGAAAAACCAGACCCCAATAATCT
GGTTTTTGGAACTGTGTTCACGGATCATATGCTGACGGTGGAGTGGTCCTCAGAGTTTGGATGGGAGAAA
CCTCATATCAAGCCTCTTCAGAACCTGTCATTGCACCCTGGCTCATCAGCTTTGCACTATGCAGTGGAAT
TATTTGAAGGATTGAAGGCATTTCGAGGAGTAGATAATAAAATTCGACTGTTTCAGCCAAACCTCAACAT
GGATAGAATGTATCGCTCTGCTGTGAGGGCAACTCTGCCGGTATTTGACAAAGAAGAGCTCTTAGAGTGT
ATTCAACAGCTTGTGAAATTGGATCAAGAATGGGTCCCATATTCAACATCTGCTAGTCTGTATATTCGTC
CTACATTCATTGGAACTGAGCCTTCTCTTGGAGTCAAGAAGCCTACCAAAGCCCTGCTCTTTGTACTCTT
GAGCCCAGTGGGACCTTATTTTTCAAGTGGAACCTTTAATCCAGTGTCCCTGTGGGCCAATCCCAAGTAT
GTAAGAGCCTGGAAAGGTGGAACTGGGGACTGCAAGATGGGAGGGAATTACGGCTCATCTCTTTTTGCCC
AATGTGAAGCAGTAGATAATGGGTGTCAGCAGGTCCTGTGGCTCTATGGAGAGGACCATCAGATCACTGA
AGTGGGAACTATGAATCTTTTTCTTTACTGGATAAATGAAGATGGAGAAGAAGAACTGGCAACTCCTCCA
CTAGATGGCATCATTCTTCCAGGAGTGACAAGGCGGTGCATTCTGGACCTGGCACATCAGTGGGGTGAAT
TTAAGGTGTCAGAGAGATACCTCACCATGGATGACTTGACAACAGCCCTGGAGGGGAACAGAGTGAGAGA
GATGTTTGGCTCTGGTACAGCCTGTGTTGTTTGCCCAGTTTCTGATATACTGTACAAAGGCGAGACAATA
CACATTCCAACTATGGAGAATGGTCCTAAGCTGGCAAGCCGCATCTTGAGCAAATTAACTGATATCCAGT
ATGGAAGAGAAGAGAGCGACTGGACAATTGTGCTATCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC219229 representing NM_005504
Red=Cloning site Green=Tags(s)

MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEK
PHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLEC
IQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKY
VRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPP
LDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETI
HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005504
ORF Size 1158 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005504.7
RefSeq Size 8191 bp
RefSeq ORF 1161 bp
Locus ID 586
UniProt ID P54687, A0A024RAV0
Cytogenetics 12p12.1
Domains aminotran_4
Protein Families Druggable Genome
Protein Pathways leucine and isoleucine biosynthesis, leucine and isoleucine degradation, Metabolic pathways, Pantothenate and CoA biosynthesis, Valine
MW 42.8 kDa
Summary This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders. Alternatively spliced transcript variants have been described. provided by RefSeq, May 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005504" in other vectors (6)
SKU Description Size Price
RC219229L1 Lenti ORF clone of Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC219229L2 Lenti ORF clone of Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC219229L3 Lenti ORF clone of Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC219229L4 Lenti ORF clone of Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG219229 BCAT1 (tGFP-tagged) - Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1 10 ug
$489.00 $657.00
SC116691 BCAT1 (untagged)-Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1 10 ug
$457.00

Plasmid Map for RC219229

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC219229
Circular map for RC219229

file-alt Citations

BCAT1 overexpression regulates proliferation and c‑Myc/GLUT1 signaling in head and neck squamous cell carcinoma
Wang, Wang, Ouyang et al
Oncol Rep (2021) 45 (5) DOI: 10.3892/or.2021.8003
Cited by 22
AI Summary: OriGene’s pCMV6-BCAT1 and control pCMV6 plasmids were used to manipulate BCAT1 expression in cell experiments, enabling the study of BCAT1’s role in head and neck squamous cell carcinoma proliferation and signaling pathways.
Snippet: Cells were cultured with RPMI-1640 medium (Gibco;Thermo Fisher Scientific, Inc.) with 10% FBS (Gibco;Thermo Fisher Scientific, Inc.) under 5% CO2 at 37°C. pCMV6-BCAT1 plasmid (1 µg) and control pCMV6 plasmid (OriGene Technologies, Inc.) were transfected
FigureFigureFigure
BCAT1 Overexpression Promotes Proliferation, Invasion, and Wnt Signaling in Non-Small Cell Lung Cancers
Lin, Tan, Fu et al
Onco Targets Ther (2020) 13, 3583-3594 DOI: 10.2147/OTT.S237306
AI Summary: OriGene contributed to this study by providing the pCMV6-BCAT1 plasmid and empty vector, which were used to overexpress BCAT1 in cell lines to investigate its role in non-small cell lung cancer proliferation, invasion, and Wnt signaling.
Snippet: … Empty vector and pCMV6-BCAT1 were from Origene and transfected into cells using Lipofectamine 3000 (Invitrogen, USA). …Empty vector and pCMV6-BCAT1 were from Origene and transfected into cells using Lipofectamine 3000 (Invitrogen, USA). siGENOME siRNA for BCAT1 (Dharmacon, USA) was used for knockdown experiments using Dharmafect1 reagent (Dharmacon, USA)
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products