OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPIN2B (NM_001006683) Human Mass Spec Standard

Be the first to review this product
SKU
PH313224
SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA323478 Anti-SPIN2B Rabbit Polyclonal Antibody
100 ul
$305.00
LY423547 Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SPIN2B or NM_001006683"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213224
Predicted MW 29.2 kDa
Protein Sequence
Protein Sequence
>RC213224 protein sequence
Red=Cloning site Green=Tags(s)

MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG
TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE
HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI
GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001006684
RefSeq Size 1216
RefSeq ORF 774
Synonyms dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26
Locus ID 474343
UniProt ID Q9BPZ2
Cytogenetics Xp11.21
Summary Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPIN2B" proteins (7)
SKU Description Size Price
PH310041 SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) 10 ug
$3,360.00
LC423547 Lyophilized SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423549 Lyophilized SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423547 Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423549 Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP310041 Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg 20 ug
$867.00
TP313224 Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products