SPIN2B (NM_001006681) Human Recombinant Protein

SKU
TP310041
Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210041 protein sequence
Red=Cloning site Green=Tags(s)

MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG
TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE
HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI
GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001006682
Locus ID 474343
UniProt ID Q9BPZ2
Cytogenetics Xp11.21
RefSeq Size 1277
RefSeq ORF 774
Synonyms dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26
Summary Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SPIN2B (NM_001006681) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310041 SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) 10 ug
$3,255.00
PH313224 SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684) 10 ug
$3,255.00
LC423547 SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423549 SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423547 Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 100 ug
$436.00
LY423549 Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 100 ug
$436.00
TP313224 Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.