OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPIN2B (NM_001006683) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313224
Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA323478 Anti-SPIN2B Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SPIN2B or NM_001006683"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213224 protein sequence
Red=Cloning site Green=Tags(s)

MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG
TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE
HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI
GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001006684
Locus ID 474343
UniProt ID Q9BPZ2
Cytogenetics Xp11.21
RefSeq Size 1216
RefSeq ORF 774
Synonyms dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26
Summary Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPIN2B" proteins (7)
SKU Description Size Price
PH310041 SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) 10 ug
$3,360.00
PH313224 SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684) 10 ug
$3,360.00
LC423547 Lyophilized SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423549 Lyophilized SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423547 Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423549 Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP310041 Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products