S100A5 (NM_002962) Human Mass Spec Standard

CAT#: PH310891

S100A5 MS Standard C13 and N15-labeled recombinant protein (NP_002953)

Product Images

Coomassie blue staining of purified S100A5 protein (Cat# TP310891). The protein was produced from HEK293T cells transfected with S100A5 cDNA clone (Cat# RC210891) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210891
• Predicted MW: 12.8 kDa
• Protein Sequence:
  Sequence Link

  >RC210891 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSI
  DDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002953
• RefSeq Size: 710
• RefSeq ORF: 333
• Synonyms: S100D
• Locus ID: 6276
• UniProt ID: P33763
• Cytogenetics: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain. [provided by RefSeq, Jul 2008]