S100A5 (NM_002962) Human Tagged ORF Clone
SKU
RC210891
S100A5 (Myc-DDK-tagged)-Human S100 calcium binding protein A5 (S100A5)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | S100A5 |
Synonyms | S100D |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC210891 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCTGCTGCTTGGATTCTCTGGGCTCACTCCCACAGTGAGCTGCACACTGTGATGGAGACTCCTCTGG AGAAGGCCCTGACCACTATGGTGACCACGTTTCACAAATATTCGGGGAGAGAGGGTAGCAAACTGACCCT GAGTAGGAAGGAACTCAAGGAGCTGATCAAGAAAGAGCTGTGTCTTGGGGAGATGAAGGAGAGCAGCATC GATGACTTGATGAAGAGCCTGGACAAGAACAGCGACCAGGAGATCGACTTCAAGGAGTACTCGGTGTTCC TGACCATGCTGTGCATGGCCTACAACGACTTCTTTCTAGAGGACAACAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210891 protein sequence
Red=Cloning site Green=Tags(s) MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSI DDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002962 |
ORF Size | 330 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq Size | 710 bp |
RefSeq ORF | 279 bp |
Locus ID | 6276 |
UniProt ID | P33763 |
Cytogenetics | 1q21.3 |
MW | 12.8 kDa |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC210891L1 | Lenti ORF clone of Human S100 calcium binding protein A5 (S100A5), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC210891L2 | Lenti ORF clone of Human S100 calcium binding protein A5 (S100A5), mGFP tagged | 10 ug |
$450.00
|
|
RC210891L3 | Lenti ORF clone of Human S100 calcium binding protein A5 (S100A5), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC210891L4 | Lenti ORF clone of Human S100 calcium binding protein A5 (S100A5), mGFP tagged | 10 ug |
$450.00
|
|
RG210891 | S100A5 (tGFP-tagged) - Human S100 calcium binding protein A5 (S100A5) | 10 ug |
$489.00
|
|
SC303255 | S100A5 (untagged)-Human S100 calcium binding protein A5 (S100A5) | 10 ug |
$165.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.