S100A5 (NM_002962) Human Tagged ORF Clone

SKU
RG210891
S100A5 (tGFP-tagged) - Human S100 calcium binding protein A5 (S100A5)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol S100A5
Synonyms S100D
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210891 representing NM_002962
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGCTGCTTGGATTCTCTGGGCTCACTCCCACAGTGAGCTGCACACTGTGATGGAGACTCCTCTGG
AGAAGGCCCTGACCACTATGGTGACCACGTTTCACAAATATTCGGGGAGAGAGGGTAGCAAACTGACCCT
GAGTAGGAAGGAACTCAAGGAGCTGATCAAGAAAGAGCTGTGTCTTGGGGAGATGAAGGAGAGCAGCATC
GATGACTTGATGAAGAGCCTGGACAAGAACAGCGACCAGGAGATCGACTTCAAGGAGTACTCGGTGTTCC
TGACCATGCTGTGCATGGCCTACAACGACTTCTTTCTAGAGGACAACAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210891 representing NM_002962
Red=Cloning site Green=Tags(s)

MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSI
DDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002962
ORF Size 330 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002962.1, NP_002953.2
RefSeq Size 710 bp
RefSeq ORF 279 bp
Locus ID 6276
UniProt ID P33763
Cytogenetics 1q21.3
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:S100A5 (NM_002962) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210891 S100A5 (Myc-DDK-tagged)-Human S100 calcium binding protein A5 (S100A5) 10 ug
$150.00
RC210891L1 Lenti ORF clone of Human S100 calcium binding protein A5 (S100A5), Myc-DDK-tagged 10 ug
$450.00
RC210891L2 Lenti ORF clone of Human S100 calcium binding protein A5 (S100A5), mGFP tagged 10 ug
$450.00
RC210891L3 Lenti ORF clone of Human S100 calcium binding protein A5 (S100A5), Myc-DDK-tagged 10 ug
$450.00
RC210891L4 Lenti ORF clone of Human S100 calcium binding protein A5 (S100A5), mGFP tagged 10 ug
$450.00
SC303255 S100A5 (untagged)-Human S100 calcium binding protein A5 (S100A5) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.