OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKRD16 (NM_019046) Human Mass Spec Standard

Be the first to review this product
SKU
PH309157
ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_061919)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330657 Rabbit Polyclonal Anti-ANKRD16 Antibody
100 ul
$585.00
LY423159 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "ANKRD16 or NM_019046"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209157
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC209157 protein sequence
Red=Cloning site Green=Tags(s)

MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD
YKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNS
FHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALM
DAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHY
AAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRAD
VLQGSGHSAMT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061919
RefSeq Size 2646
RefSeq ORF 1083
Locus ID 54522
UniProt ID Q6P6B7
Cytogenetics 10p15.1
Summary Required to prevent the misactivation of serine (Ser) with tRNA(Ala) by promoting the hydrolysis of Ser-mischarged tRNA(Ala), thereby playing a role in translational fidelity. Binds directly to the catalytic domain of AARS/AlaRS and captures Ser that is misactivated by AARS/AlaRS, preventing the charging of Ser adenylates to tRNA(Ala) and precluding Ser misincorporation in nascent peptides.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKRD16" proteins (13)
SKU Description Size Price
PH315131 ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009941) 10 ug
$3,360.00
PH322437 ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942) 10 ug
$3,360.00
LC412786 Lyophilized ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423159 Lyophilized ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423160 Lyophilized ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423161 Lyophilized ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412786 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423159 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423160 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY423161 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP309157 Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 1, 20 µg 20 ug
$867.00
TP315131 Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 2, 20 µg 20 ug
$867.00
TP322437 Purified recombinant protein of Homo sapiens ankyrin repeat domain 16 (ANKRD16), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products