ANKRD16 (NM_001009942) Human Mass Spec Standard

SKU
PH322437
ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222437]
Predicted MW 35.3 kDa
Protein Sequence
Protein Sequence
>RC222437 representing NM_001009942
Red=Cloning site Green=Tags(s)

MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD
YKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNS
FHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALM
DAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGHTSTIQTLLSLGADINSKDEKNRSALHLAC
AGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAMT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001009942
RefSeq Size 1069
RefSeq ORF 978
Synonyms ankyrin repeat domain 16; OTTHUMP00000019019; OTTHUMP00000044872
Locus ID 54522
UniProt ID Q6P6B7
Cytogenetics 10p15.1
Summary Required to prevent the misactivation of serine (Ser) with tRNA(Ala) by promoting the hydrolysis of Ser-mischarged tRNA(Ala), thereby playing a role in translational fidelity. Binds directly to the catalytic domain of AARS/AlaRS and captures Ser that is misactivated by AARS/AlaRS, preventing the charging of Ser adenylates to tRNA(Ala) and precluding Ser misincorporation in nascent peptides.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ANKRD16 (NM_001009942) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309157 ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_061919) 10 ug
$3,255.00
PH315131 ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009941) 10 ug
$3,255.00
LC412786 ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423159 ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423160 ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423161 ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412786 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 1 100 ug
$436.00
LY423159 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 2 100 ug
$436.00
LY423160 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 3 100 ug
$436.00
LY423161 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 4 100 ug
$436.00
TP309157 Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315131 Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322437 Purified recombinant protein of Homo sapiens ankyrin repeat domain 16 (ANKRD16), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.