ANKRD16 Rabbit Polyclonal Antibody

SKU TA330657

Rabbit Polyclonal Anti-ANKRD16 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ANKRD16 antibody is: synthetic peptide directed towards the N-terminal region of Human ANKRD16. Synthetic peptide located within the following region: CAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: ankyrin repeat domain 16
• Database Link:
  NP_061919
  Q6P6B7
• Background: The function of this protein remains unknown.
• Synonyms: ankyrin repeat domain 16; OTTHUMP00000019019; OTTHUMP00000044872
• Note: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%; Zebrafish: 82%

Reference Data