ANKRD16 (NM_001009941) Human Mass Spec Standard

SKU
PH315131
ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009941)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215131]
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC215131 protein sequence
Red=Cloning site Green=Tags(s)

MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD
YKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNS
FHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALM
DAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHY
AAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRAD
VLQGSGHSAMT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001009941
RefSeq Size 1683
RefSeq ORF 1083
Locus ID 54522
UniProt ID Q6P6B7
Cytogenetics 10p15.1
Summary Required to prevent the misactivation of serine (Ser) with tRNA(Ala) by promoting the hydrolysis of Ser-mischarged tRNA(Ala), thereby playing a role in translational fidelity. Binds directly to the catalytic domain of AARS/AlaRS and captures Ser that is misactivated by AARS/AlaRS, preventing the charging of Ser adenylates to tRNA(Ala) and precluding Ser misincorporation in nascent peptides.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ANKRD16 (NM_001009941) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309157 ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_061919) 10 ug
$3,255.00
PH322437 ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942) 10 ug
$3,255.00
LC412786 ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423159 ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423160 ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423161 ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412786 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 1 100 ug
$436.00
LY423159 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 2 100 ug
$436.00
LY423160 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 3 100 ug
$436.00
LY423161 Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 4 100 ug
$436.00
TP309157 Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315131 Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322437 Purified recombinant protein of Homo sapiens ankyrin repeat domain 16 (ANKRD16), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.