OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CRKL (NM_005207) Human Mass Spec Standard

Be the first to review this product
SKU
PH308129
CRKL MS Standard C13 and N15-labeled recombinant protein (NP_005198)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351105 Rabbit Polyclonal Anti-CRKL Antibody
100 ul
$205.00
LY417444 Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL) (as WB positive control) 100 ug
$436.00

Other products for "CRKL or NM_005207"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208129
Predicted MW 33.6 kDa
Protein Sequence
Protein Sequence
>RC208129 representing NM_005207
Red=Cloning site Green=Tags(s)

MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE
DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP
QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN
GRKGLFPFTHVKIFDPQNPDENE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005198
RefSeq Size 5235
RefSeq ORF 909
Locus ID 1399
UniProt ID P46109
Cytogenetics 22q11.21
Summary This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.provided by RefSeq, Jan 2009
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CRKL" proteins (3)
SKU Description Size Price
LC417444 Lyophilized CRKL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417444 Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL) (as WB positive control) 100 ug
$436.00
TP308129 Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products