CRKL (NM_005207) Human Tagged ORF Clone

SKU
RC208129
CRKL (Myc-DDK-tagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CRKL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208129 representing NM_005207
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCCGCCAGGTTCGACTCCTCGGACCGCTCCGCCTGGTATATGGGGCCGGTGTCTCGCCAGGAGG
CGCAGACCCGGCTCCAGGGCCAGCGCCACGGTATGTTCCTCGTCCGCGATTCTTCCACCTGCCCTGGGGA
CTATGTGCTGTCGGTGTCCGAGAACTCGCGGGTCTCCCACTACATCATCAACTCGCTGCCCAACCGCCGT
TTTAAGATCGGGGACCAGGAATTTGACCATTTGCCGGCCCTGCTGGAGTTTTACAAGATCCACTACCTGG
ACACCACCACCCTCATCGAGCCTGCGCCCAGGTATCCAAGCCCACCAATGGGATCTGTCTCAGCACCCAA
CCTGCCTACAGCAGAAGATAACCTGGAATATGTACGGACTCTGTATGATTTTCCTGGGAATGATGCCGAA
GACCTGCCCTTTAAAAAGGGTGAGATCCTAGTGATAATAGAGAAGCCTGAAGAACAGTGGTGGAGTGCCC
GGAACAAGGATGGCCGGGTTGGGATGATTCCTGTCCCTTATGTCGAAAAGCTTGTGAGATCCTCACCACA
CGGAAAGCATGGAAATAGGAATTCCAACAGTTATGGGATCCCAGAACCTGCTCATGCATACGCTCAACCT
CAGACCACAACTCCTCTACCTGCAGTTTCCGGTTCTCCTGGGGCAGCAATCACCCCTTTGCCATCCACAC
AGAATGGACCTGTCTTTGCGAAAGCAATCCAGAAAAGAGTACCCTGTGCTTATGACAAGACTGCCTTGGC
ATTAGAGGTTGGTGACATCGTGAAAGTCACAAGGATGAATATAAATGGCCAGTGGGAAGGCGAAGTGAAC
GGGCGCAAAGGGCTTTTCCCCTTTACGCACGTCAAAATCTTTGACCCTCAAAACCCAGATGAAAACGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208129 representing NM_005207
Red=Cloning site Green=Tags(s)

MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE
DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP
QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN
GRKGLFPFTHVKIFDPQNPDENE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005207
ORF Size 909 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005207.4
RefSeq Size 5235 bp
RefSeq ORF 912 bp
Locus ID 1399
UniProt ID P46109
Cytogenetics 22q11.21
Domains SH2, SH3
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma
MW 33.6 kDa
Summary This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.[provided by RefSeq, Jan 2009]
Write Your Own Review
You're reviewing:CRKL (NM_005207) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208129L1 Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), Myc-DDK-tagged 10 ug
$750.00
RC208129L2 Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), mGFP tagged 10 ug
$750.00
RC208129L3 Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), Myc-DDK-tagged 10 ug
$750.00
RC208129L4 Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), mGFP tagged 10 ug
$750.00
RG208129 CRKL (tGFP-tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL) 10 ug
$650.00
SC116881 CRKL (untagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.