OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRKAR1B (NM_002735) Human Mass Spec Standard

Be the first to review this product
SKU
PH307809
PRKAR1B MS Standard C13 and N15-labeled recombinant protein (NP_002726)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502750 PRKAR1B (PKA regulatory subunit I beta) mouse monoclonal antibody, clone OTI2A3 (formerly 2A3) 100 ul
$447.00
LY431891 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PRKAR1B or NM_002735"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207809
Predicted MW 43.1 kDa
Protein Sequence
Protein Sequence
>RC207809 protein sequence
Red=Cloning site Green=Tags(s)

MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQK
SNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAH
LDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTP
RAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGE
KIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKL
DRPRFERVLGPCSEILKRNIQRYNSFISLTV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002726
RefSeq Size 2512
RefSeq ORF 1143
Synonyms PRKAR1
Locus ID 5575
UniProt ID P31321
Cytogenetics 7p22.3
Summary The protein encoded by this gene is a regulatory subunit of cyclic AMP-dependent protein kinase A (PKA), which is involved in the signaling pathway of the second messenger cAMP. Two regulatory and two catalytic subunits form the PKA holoenzyme, disbands after cAMP binding. The holoenzyme is involved in many cellular events, including ion transport, metabolism, and transcription. Several transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Aug 2015
Protein Families Druggable Genome
Protein Pathways Apoptosis, Insulin signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRKAR1B" proteins (18)
SKU Description Size Price
LC400964 Lyophilized PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431887 Lyophilized PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431888 Lyophilized PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431889 Lyophilized PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431890 Lyophilized PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431891 Lyophilized PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400964 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431887 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431888 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY431889 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY431890 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY431891 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP307809 Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), 20 µg 20 ug
$867.00
TP328859 Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 3, 20 µg 20 ug
$867.00
TP328860 Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 4, 20 µg 20 ug
$867.00
TP328861 Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 5, 20 µg 20 ug
$867.00
TP328862 Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 6, 20 µg 20 ug
$867.00
TP328863 Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products