PRKAR1B (NM_002735) Human Recombinant Protein
SKU
TP307809
Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC207809 protein sequence
Red=Cloning site Green=Tags(s) MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQK SNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAH LDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTP RAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGE KIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKL DRPRFERVLGPCSEILKRNIQRYNSFISLTV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002726 |
Locus ID | 5575 |
UniProt ID | P31321 |
Cytogenetics | 7p22.3 |
RefSeq Size | 2512 |
RefSeq ORF | 1143 |
Synonyms | PRKAR1 |
Summary | The protein encoded by this gene is a regulatory subunit of cyclic AMP-dependent protein kinase A (PKA), which is involved in the signaling pathway of the second messenger cAMP. Two regulatory and two catalytic subunits form the PKA holoenzyme, disbands after cAMP binding. The holoenzyme is involved in many cellular events, including ion transport, metabolism, and transcription. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Apoptosis, Insulin signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307809 | PRKAR1B MS Standard C13 and N15-labeled recombinant protein (NP_002726) | 10 ug |
$3,255.00
|
|
LC400964 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431887 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431888 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431889 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431890 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431891 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400964 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 2 | 100 ug |
$436.00
|
|
LY431887 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 3 | 100 ug |
$436.00
|
|
LY431888 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 4 | 100 ug |
$436.00
|
|
LY431889 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 5 | 100 ug |
$436.00
|
|
LY431890 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 6 | 100 ug |
$436.00
|
|
LY431891 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 1 | 100 ug |
$436.00
|
|
TP328859 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP328860 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP328861 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP328862 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 6, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP328863 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.