OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FYN (NM_153048) Human Mass Spec Standard

Be the first to review this product
SKU
PH307620
FYN MS Standard C13 and N15-labeled recombinant protein (NP_694593)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA376404 Fyn Rabbit polyclonal Antibody
100 ul
$410.00
LY407122 Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "FYN or NM_153048"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207620
Predicted MW 54.5 kDa
Protein Sequence
Protein Sequence
>RC207620 protein sequence
Red=Cloning site Green=Tags(s)

MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS
SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP
VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN
GGYYITTRAQFETLQQLVQHYSGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSE
EPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICK
IADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREV
LEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_694593
RefSeq Size 2959
RefSeq ORF 1446
Synonyms p59-FYN; SLK; SYN
Locus ID 2534
UniProt ID P06241
Cytogenetics 6q21
Summary This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FYN" proteins (11)
SKU Description Size Price
PH319374 FYN MS Standard C13 and N15-labeled recombinant protein (NP_694592) 10 ug
$3,360.00
PH324691 FYN MS Standard C13 and N15-labeled recombinant protein (NP_002028) 10 ug
$3,360.00
LC400745 Lyophilized FYN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403505 Lyophilized FYN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407122 Lyophilized FYN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400745 Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY403505 Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY407122 Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP307620 Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3, 20 µg 20 ug
$737.00
TP319374 Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2, 20 µg 20 ug
$737.00
TP324691 Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products