FYN (NM_153047) Human Recombinant Protein
SKU
TP319374
Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC219374 representing NM_153047
Red=Cloning site Green=Tags(s) MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN GGYYITTRAQFETLQQLVQHYSEKADGLCFNLTVIASSCTPQTSGLAKDAWEVARRSLCLEKKLGQGCFA EVWLGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDF LKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTAR QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPI SLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_694592 |
Locus ID | 2534 |
UniProt ID | P06241 |
Cytogenetics | 6q21 |
RefSeq Size | 2073 |
RefSeq ORF | 1602 |
Synonyms | p59-FYN; SLK; SYN |
Summary | This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307620 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_694593) | 10 ug |
$3,255.00
|
|
PH319374 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_694592) | 10 ug |
$3,255.00
|
|
PH324691 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_002028) | 10 ug |
$3,255.00
|
|
LC400745 | FYN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC403505 | FYN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC407122 | FYN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400745 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1 | 100 ug |
$665.00
|
|
LY403505 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2 | 100 ug |
$665.00
|
|
LY407122 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3 | 100 ug |
$436.00
|
|
TP307620 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP324691 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.