FYN (NM_153047) Human Mass Spec Standard

SKU
PH319374
FYN MS Standard C13 and N15-labeled recombinant protein (NP_694592)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219374]
Predicted MW 60 kDa
Protein Sequence
Protein Sequence
>RC219374 representing NM_153047
Red=Cloning site Green=Tags(s)

MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS
SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP
VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN
GGYYITTRAQFETLQQLVQHYSEKADGLCFNLTVIASSCTPQTSGLAKDAWEVARRSLCLEKKLGQGCFA
EVWLGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDF
LKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTAR
QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPI
SLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_694592
RefSeq Size 2073
RefSeq ORF 1602
Synonyms p59-FYN; SLK; SYN
Locus ID 2534
UniProt ID P06241
Cytogenetics 6q21
Summary This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis
Write Your Own Review
You're reviewing:FYN (NM_153047) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307620 FYN MS Standard C13 and N15-labeled recombinant protein (NP_694593) 10 ug
$3,255.00
PH324691 FYN MS Standard C13 and N15-labeled recombinant protein (NP_002028) 10 ug
$3,255.00
LC400745 FYN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403505 FYN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407122 FYN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400745 Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1 100 ug
$665.00
LY403505 Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2 100 ug
$665.00
LY407122 Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3 100 ug
$436.00
TP307620 Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3, 20 µg 20 ug
$737.00
TP319374 Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2, 20 µg 20 ug
$737.00
TP324691 Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.